Transcript | Ll_transcript_408018 |
---|---|
CDS coordinates | 3-314 (+) |
Peptide sequence | EDNNYTELRKEVAEKTQQLRRMKGEEFEGLNLDDVQHLEERLEEGLKRVIMAKEKLIEDEIVALQKKIIMISKGKTPSMVDSNIPIHENISSDSMNNVCSCNSG |
ORF Type | internal |
Blastp | MADS-box protein JOINTLESS from Lycopersicon with 50.75% of identity |
---|---|
Blastx | MADS-box protein JOINTLESS from Lycopersicon with 50.75% of identity |
Eggnog | Transcription factor(COG5068) |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019454786.1) |
Pfam | K-box region (PF01486.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer