Transcript | Ll_transcript_12972 |
---|---|
CDS coordinates | 106-885 (+) |
Peptide sequence | MSPLNSSNPCLPKTHFLKVPTFDPFFKFKSFSFNTHIPPNRAHALSFSINSKLKSSQDIQNNKGKKGVSQKIVLSEVTPPPLTENNDDINGGSGNGNENVPAKSRNKRGVSGLAKMLSKRTLQILSNLPLAIGEMFTIAALMALGTFIDQGEPPEHYFQQYPEDHPVLGFFTWRWVLALGFDHMYSSPVFLGMLVLLGASLMACTYTTQIPLVKVSRRWSFLHSAETIRKQEFSESLPRASIEDVGTILMGSGYEVIIS* |
ORF Type | complete |
Blastp | Cytochrome c biogenesis protein CCS1, chloroplastic from Arabidopsis with 57.53% of identity |
---|---|
Blastx | Cytochrome c biogenesis protein CCS1, chloroplastic from Arabidopsis with 78.57% of identity |
Eggnog | Cytochrome c biogenesis protein(COG1333) |
Kegg | Link to kegg annotations (AT1G49380) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413181.1) |
Pfam | ResB-like family (PF05140.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer