Protein coding transcript 136530

• Transcript: Ll_transcript_12975
• CDS coordinates: 1494-2339 (+)
• Peptide sequence: MAGGTLSALGSFKGSVTVPQGLNFVAGDVLGPTGFLSSPNEDFNTEIHVNRFFMDYYDSGEVSQFHSDLSLFNMDGKEVMRKTISVNDPLRYGGITIYQTDWSISALQILKNNEGPYNLAMAPLQINGDKKLYGTFMPIGDVNSSDVKGISMLARDLQSIVLYDADGKFAGIRRPNSKLPININGTEIVILDAIGSSGLDLKTDPGVPIVYAGFGALMLTTCISYLSHSQVWALQDGTSVVIGGKSNRAKMEFPEEMNRLLDKVPEIVQSSLSEQAGGIRG*
• ORF Type: complete

Annotations of Ll_transcript_12975

• Blastp: Cytochrome c biogenesis protein CCS1, chloroplastic from Arabidopsis with 77.06% of identity
• Blastx: Cytochrome c biogenesis protein CCS1, chloroplastic from Arabidopsis with 77.56% of identity
• Eggnog: Cytochrome c biogenesis protein(COG1333)
• Kegg: Link to kegg annotations (AT1G49380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413181.1)
• Pfam: ResB-like family (PF05140.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;