Protein coding transcript 136533

• Transcript: Ll_transcript_12978
• CDS coordinates: 106-885 (+)
• Peptide sequence: MSPLNSSNPCLPKTHFLKVPTFDPFFKFKSFSFNTHIPPNRAHALSFSINSKLKSSQDIQNNKGKKGVSQKIVLSEVTPPPLTENNDDINGGSGNGNENVPAKSRNKRGVSGLAKMLSKRTLQILSNLPLAIGEMFTIAALMALGTFIDQGEPPEHYFQQYPEDHPVLGFFTWRWVLALGFDHMYSSPVFLGMLVLLGASLMACTYTTQIPLVKVSRRWSFLHSAETIRKQEFSESLPRASIEDVGTILMGSGYEVIIS*
• ORF Type: complete

Annotations of Ll_transcript_12978

• Blastp: Cytochrome c biogenesis protein CCS1, chloroplastic from Arabidopsis with 57.53% of identity
• Blastx: Cytochrome c biogenesis protein CCS1, chloroplastic from Arabidopsis with 78.57% of identity
• Eggnog: Cytochrome c biogenesis protein(COG1333)
• Kegg: Link to kegg annotations (AT1G49380)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413181.1)
• Pfam: ResB-like family (PF05140.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;