Protein coding transcript 136543

• Transcript: Ll_transcript_209326
• CDS coordinates: 258-989 (+)
• Peptide sequence: MAHEDWDLFAIVRSCKAATFTTPTTTTQTPLTATTSITRTPSPKGTATFIANQENDPFSFATNIVQPRTTGFQELHPLFMNFNPTSTINTTSTSGNSINPNFIFSDFSRSIEQQQHHHTTVLAPTTTYTNIGVPTSGFEIFHQQQPQHLEEPQQHQQQQEQKQHNQLHVQVPQNTSMILPTTQTQTPKSRKRKSQQKKTVSHVTADNLSSDLWAWRKYGQKPIKGSPYPRYIYNTENTFSHSP*
• ORF Type: complete

Annotations of Ll_transcript_209326

• Blastp: Probable WRKY transcription factor 27 from Arabidopsis with 72.55% of identity
• Blastx: Probable WRKY transcription factor 27 from Arabidopsis with 80% of identity
• Eggnog: WRKY(ENOG41114CW)
• Kegg: Link to kegg annotations (AT5G52830)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019451516.1)
• Pfam: WRKY DNA -binding domain (PF03106.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;