Protein coding transcript 136594

• Transcript: Ll_transcript_209361
• CDS coordinates: 49-1059 (+)
• Peptide sequence: MGSHITFSLILHLLLLILCSLNQPSFAFTSQEYYEALEKSILFFEGQRSGRLPSNHRVTWRGDSGLYDGSSYNVDLVGGYYDAGDNVKFGFPMAFSTTLLAWSVIEFGSSMQKEVENVRAAIRWSTDYLLKAATTTPHTLYVQVGEPNMDHHCWERPEDMDTPRNVYKVSTQNPGSDVAAETAAALAASSLVFKDSDPTYSSILLQTAIQVFNFADNYRGSYSDSLNSVVCPFYCSYSGYHDELLWGASWIYKASGDSSYIQYIRSNGHTLGADDDVYSFSWDDKRAGNKILLSKVPHFLFIKVNSIHYVEPRLIYTNGREITGILGGKLRRIRIV*
• ORF Type: complete

Annotations of Ll_transcript_209361

• Blastp: Endoglucanase 1 from Persea with 67.28% of identity
• Blastx: Endoglucanase 1 from Persea with 63.03% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_020215505.1)
• Pfam: Glycosyl hydrolase family 9 (PF00759.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;