Protein coding transcript 136615

• Transcript: Ll_transcript_209378
• CDS coordinates: 208-717 (+)
• Peptide sequence: MLVIEECKNSRAVTIFIRGGNKMIIEEAKRSLHDALCVVRNLVQDDRVVYGGGAAEISCAIAVSQEADKISTLEQYAFRAFADALEMIPLSLAENSGLSNMETLTEVKARQVKEKNPALGIDCMLKGTSDMKEQHVIETLHSKKQQLLLATQMVKMILKIDDIRSPADR*
• ORF Type: complete

Annotations of Ll_transcript_209378

• Blastp: T-complex protein 1 subunit epsilon from Macaca with 80.36% of identity
• Blastx: T-complex protein 1 subunit epsilon from Macaca with 80% of identity
• Eggnog: -
• Kegg: Link to kegg annotations (101926268)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003538584.1)
• Pfam: TCP-1/cpn60 chaperonin family (PF00118.23)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;