| Transcript | Ll_transcript_209403 |
|---|---|
| CDS coordinates | 351-698 (+) |
| Peptide sequence | MLLQTKEDEYLEQKMERIPFLEEQVRMIKDQGKLLTMDIERLLLSEDNRFDFVNEIAAEANSYVENNMDDYGLEKKAILHVLSNRMNDAGFYRPEAYAESDPFKPGPHFLKEELP* |
| ORF Type | complete |
| Blastp | Protein PLASTID TRANSCRIPTIONALLY ACTIVE 7 from Arabidopsis with 65.74% of identity |
|---|---|
| Blastx | Protein PLASTID TRANSCRIPTIONALLY ACTIVE 7 from Arabidopsis with 65.74% of identity |
| Eggnog | NA(ENOG410YIZX) |
| Kegg | Link to kegg annotations (AT5G24314) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019415997.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer