Protein coding transcript 13666

• Transcript: Ll_transcript_323890
• CDS coordinates: 43-1230 (+)
• Peptide sequence: MNMIQTQHSLPQLQEQLQQNDRKRQQPSSPEADNSIIGGNNVEKSMMMDGTNGTGGLASSSNLVVGTKGDNIESFQPEDGGDREKAYGTINQTLDKQKEEASKSFTFTEFKCIRMTNSKVTCCDFSSDEKFIASAGHDNKVVLWNMDTLKKENTPEDHKSVISDIRFRPNSSVFVTSCIDNCVRLWDAANPRFCLEQYNVHSSAVMSVDFHPKQTDLLCVSDSKNEIQYWNITTSSFINSFKGGNAKVRFQPGAGQVLAAAYDNGVSIFDAETGTYVYSLQGHPEAVSYICWDANGNTLASMSPNLIKIWSLSSGECVREYGSTSENQFHSCVFHPRNSTILVIGGNSYLELWNIDKNRTLPILAHKDIISSLVHSPVTGIVASASHDGFVKLWK*
• ORF Type: complete

Annotations of Ll_transcript_323890

• Blastp: Transcriptional corepressor LEUNIG_HOMOLOG from Arabidopsis with 44.94% of identity
• Blastx: Transcriptional corepressor LEUNIG_HOMOLOG from Arabidopsis with 44.94% of identity
• Eggnog: transcriptional co-repressor(ENOG410YDHV)
• Kegg: Link to kegg annotations (AT2G32700)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019465439.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;