Transcript | Ll_transcript_230360 |
---|---|
CDS coordinates | 198-572 (+) |
Peptide sequence | MATKFASLRGTIEKMGSNLGFKRCIHSVPNSPPLAGSIDLGVPSMPQPVLPEYSAPSFSFGGSMELMAVPKKKTSPHKRGIRNGPKALKPIPVIVLCKGCGRVRLPHYYCCSGKPKEGGHEGTK* |
ORF Type | complete |
Blastp | 50S ribosomal protein L32 from Ochrobactrum with 54.76% of identity |
---|---|
Blastx | - |
Eggnog | 50s ribosomal protein l32(COG0333) |
Kegg | Link to kegg annotations (Oant_1128) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019461406.1) |
Pfam | Ribosomal L32p protein family (PF01783.22) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer