Protein coding transcript 136876

• Transcript: Ll_transcript_230324
• CDS coordinates: 176-1186 (+)
• Peptide sequence: MSSFSIPFLTPPCSSNTISSRPKICLYATPAVSPIVSSEVDASRLEPRVEERDGYWVLKEEYRVGINPQEKVKLEKEPMALFMEGGIHELAKMSLQEIDSSKLTKDDIDVRLKWLGLFHRRKHQYGRFMMRLKLPNGVTTSVQTRYLASVIKKYGKDGCADVTTRQNWQIRGVVLPDVPEILKGLAEVGLNSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTNLLSQFITANSLGNPTISNLPRKWNVCVVGSHDLFEHPHINDLAYMPAIKNGRFGFNLLVGGFFSPKRCAEAIPLDAWVSADDVIPLCKAVLEAYRDLGTRGNRQKNKNDVVD*
• ORF Type: complete

Annotations of Ll_transcript_230324

• Blastp: Ferredoxin--nitrite reductase, chloroplastic from Betula with 82.18% of identity
• Blastx: Ferredoxin--nitrite reductase, chloroplastic from Betula with 82.18% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019445788.1)
• Pfam: Nitrite/Sulfite reductase ferredoxin-like half domain (PF03460.16)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;