Transcript | Ll_transcript_230324 |
---|---|
CDS coordinates | 176-1186 (+) |
Peptide sequence | MSSFSIPFLTPPCSSNTISSRPKICLYATPAVSPIVSSEVDASRLEPRVEERDGYWVLKEEYRVGINPQEKVKLEKEPMALFMEGGIHELAKMSLQEIDSSKLTKDDIDVRLKWLGLFHRRKHQYGRFMMRLKLPNGVTTSVQTRYLASVIKKYGKDGCADVTTRQNWQIRGVVLPDVPEILKGLAEVGLNSLQSGMDNVRNPVGNPLAGIDPHEIVDTRPYTNLLSQFITANSLGNPTISNLPRKWNVCVVGSHDLFEHPHINDLAYMPAIKNGRFGFNLLVGGFFSPKRCAEAIPLDAWVSADDVIPLCKAVLEAYRDLGTRGNRQKNKNDVVD* |
ORF Type | complete |
Blastp | Ferredoxin--nitrite reductase, chloroplastic from Betula with 82.18% of identity |
---|---|
Blastx | Ferredoxin--nitrite reductase, chloroplastic from Betula with 82.18% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019445788.1) |
Pfam | Nitrite/Sulfite reductase ferredoxin-like half domain (PF03460.16) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer