Protein coding transcript 136917

• Transcript: Ll_transcript_230434
• CDS coordinates: 110-646 (-)
• Peptide sequence: VGFKTPQGAIPIPNANGAIPTVNGVTGIPLGTGLAGTTFAGNSGNNNQNNVQLQLGPDGLGLGFGTITVIDDILTSQPELGSQIVGKAQGVYVASSADGSRQMMAFTALFEGGEYGDSLNFYGLYKIGSTMSHLSVIGGTGKFKNAKGFAELRGLIPPGQIATDGAETLLRITVHLSY*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_230434

• Blastp: Dirigent protein 16 from Arabidopsis with 72.47% of identity
• Blastx: Dirigent protein 16 from Arabidopsis with 66.85% of identity
• Eggnog: disease resistance-responsive family protein(ENOG410YCDB)
• Kegg: Link to kegg annotations (AT3G24020)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019413949.1)
• Pfam: Dirigent-like protein (PF03018.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;