Transcript | Ll_transcript_230435 |
---|---|
CDS coordinates | 481-816 (-) |
Peptide sequence | MSIAANAIDPITATGKEPIIELYMHDIVGGSNPTARPVTGLLGNIYSGQVPFATPVGFKTPQGAIPIPNANGAIPSVNGVTGIPLGTGLAGTTFAGSNNNNNNQIIMDSYS* |
ORF Type | complete |
Blastp | Dirigent protein 18 from Arabidopsis with 65.98% of identity |
---|---|
Blastx | Dirigent protein 18 from Arabidopsis with 76.99% of identity |
Eggnog | disease resistance-responsive family protein(ENOG410YCDB) |
Kegg | Link to kegg annotations (AT4G13580) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019412711.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer