Protein coding transcript 136918

• Transcript: Ll_transcript_230435
• CDS coordinates: 481-816 (-)
• Peptide sequence: MSIAANAIDPITATGKEPIIELYMHDIVGGSNPTARPVTGLLGNIYSGQVPFATPVGFKTPQGAIPIPNANGAIPSVNGVTGIPLGTGLAGTTFAGSNNNNNNQIIMDSYS*
• ORF Type: complete

Annotations of Ll_transcript_230435

• Blastp: Dirigent protein 18 from Arabidopsis with 65.98% of identity
• Blastx: Dirigent protein 18 from Arabidopsis with 76.99% of identity
• Eggnog: disease resistance-responsive family protein(ENOG410YCDB)
• Kegg: Link to kegg annotations (AT4G13580)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019412711.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;