Transcript | Ll_transcript_95606 |
---|---|
CDS coordinates | 1571-2086 (+) |
Peptide sequence | MRGYYKPVCGVIGGPKFSSKSVSQEAESFLLDAVNMSFFERLNLAWKIIFPSAVSRKSSNARIAKQRLKMILFSDRCAISDEAKQKIVSNVVRALSDFVEIESQDKVQLSVSADTDLGTIYSVTVPVRRVKPEYQDADESGMITNVEYKDTGVSSGSVDVTFDFFVPDEMS* |
ORF Type | complete |
Blastp | Cell division topological specificity factor homolog, chloroplastic from Arabidopsis with 71.26% of identity |
---|---|
Blastx | Cell division topological specificity factor homolog, chloroplastic from Arabidopsis with 66.16% of identity |
Eggnog | Septum formation topological specificity factor MinE(ENOG41122SR) |
Kegg | Link to kegg annotations (AT1G69390) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019433390.1) |
Pfam | Septum formation topological specificity factor MinE (PF03776.13) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer