Protein coding transcript 136976

• Transcript: Ll_transcript_95641
• CDS coordinates: 260-868 (+)
• Peptide sequence: MASNELKQRLTQNPSTTTMNNKKRNIGVGRRDKRMAMAKRGFKSLAIAVSLPLSLTLLSMYLGSSLHTQQHGHYYDDDDVVVASTKPFWFTPSWVLHLMCPASSFLMGISAWMVWADGGFHTNPVALLLYLAQILFTLLWDPLVFGLGATRVGLMVCLGLFGALSGCMHVFRQLNSVAGDFTKPCLACAAFLSVVNVKLLFV*
• ORF Type: complete

Annotations of Ll_transcript_95641

• Blastp: Translocator protein homolog from Arabidopsis with 44.39% of identity
• Blastx: Translocator protein homolog from Arabidopsis with 43.14% of identity
• Eggnog: TspO/MBR family(ENOG410YY8X)
• Kegg: Link to kegg annotations (AT2G47770)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019419271.1)
• Pfam: TspO/MBR family (PF03073.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;