| Transcript | Ll_transcript_95537 |
|---|---|
| CDS coordinates | 219-689 (+) |
| Peptide sequence | MPRVDVWVQEFLKHEIPCVLADYLVEYVCKPGFSLERHVLYGTHTWAERSYDKLQSKAEEIIEELIPPKVCDEDNKEEDAICQVCGSGDRGDVMLICGDEKGSVGCGVGTHIDCCDPPLTEVPEEDWFCPKCNETSKCSNSSKKRKKGVMSSSKRE* |
| ORF Type | complete |
| Blastp | BRCT domain-containing protein At4g02110 from Arabidopsis with 67.8% of identity |
|---|---|
| Blastx | BRCT domain-containing protein At4g02110 from Arabidopsis with 69.79% of identity |
| Eggnog | Topoisomerase (DNA) II binding protein 1(ENOG410XPFH) |
| Kegg | Link to kegg annotations (AT4G02110) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019428149.1) |
| Pfam | PHD-finger (PF00628.28) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer