Protein coding transcript 1370

• Transcript: Ll_transcript_408055
• CDS coordinates: 3-302 (+)
• Peptide sequence: WLVSWNAGRSTYNTSRIAVLDSLGQFVSSDNFTVMVTDYGTVLQRILKVDCDGNIRVYGRRNGEEEWYVSWQSNLTPCRIHGICGANSMCTYDPNSGRS*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_408055

• Blastp: Putative receptor protein kinase ZmPK1 from Zea with 36.56% of identity
• Blastx: Putative receptor protein kinase ZmPK1 from Zea with 36.56% of identity
• Eggnog: Serine Threonine protein kinase(COG0515)
• Kegg: Link to kegg annotations (542378)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_003622965.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;