Protein coding transcript 137007

• Transcript: Ll_transcript_95661
• CDS coordinates: 535-1536 (+)
• Peptide sequence: MGGASLPPGFRFHPTDEELVGYYLKRKLEGLEIELEVIPVIDLYKFDPWELPEKSFLPNRDLEWFFFCPRDRKYPNGSRTNRATKAGYWKATGKDKKVVCQFSPSTSTTTSIVTGYRKTLVFYRGRAPLGDRTDWIMHEYRLCDDLAQPSPSFRGAFALCRVIKKNEKVNDFPGEVQKGKRAAGSSSSNGNDTSMKLTLSNELLSISGDISSHASQMCNESLYSSPIASPSPYNNVAPIPSMDTNPSHFWLSPDMILDSSKEYTQAQDIVPGYFPQRDLSTMTPWQSFDYADISSSSSYSNFNMEIEFSDDLGRIGCMSPYSGQGNLMDILWK*
• ORF Type: complete

Annotations of Ll_transcript_95661

• Blastp: NAC domain-containing protein 71 from Arabidopsis with 55.09% of identity
• Blastx: NAC domain-containing protein 71 from Arabidopsis with 55.09% of identity
• Eggnog: NAC domain containing protein(ENOG410YB66)
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019422954.1)
• Pfam: No apical meristem (NAM) protein (PF02365.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;