Protein coding transcript 137030

• Transcript: Ll_transcript_95710
• CDS coordinates: 743-1429 (+)
• Peptide sequence: MLKTYEERTSAVGYVVERLGEERIPGIRNELYPVTSSFGAPIFFSLERAAAPYFGIKAYGIHMNGYVELDGQKHLWIAKRSSTKPTYPGMLDHLVAGGLPHGIDCHENVVKECEEEAGIPRPISIKAIPVGAVSYMDIDEYRYKRDVLFCYDLKLPESFVPKNEDGEVDSFKLIPVVQVAEVIRKTQFFKPNCSLVIIDFLFRHGYYSLFSTFSRHFPGISLFININS*
• ORF Type: complete

Annotations of Ll_transcript_95710

• Blastp: Nudix hydrolase 20, chloroplastic from Arabidopsis with 75.85% of identity
• Blastx: Nudix hydrolase 20, chloroplastic from Arabidopsis with 70.42% of identity
• Eggnog: Nudix hydrolase(COG0494)
• Kegg: Link to kegg annotations (AT5G19460)
• CantataDB: Link to cantataDB annotations (CNT0000325)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458672.1)
• Pfam: Domain of unknown function (DUF4743) (PF15916.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;