Protein coding transcript 137032

• Transcript: Ll_transcript_95700
• CDS coordinates: 271-768 (+)
• Peptide sequence: MNGYVELDGQKHLWIAKRSSTKPTYPGMLDHLVAGGLPHGIDCHENVVKECEEEAGIPRPISIKAIPVGAVSYMDIDEYRYKRDVLFCYDLKLPESFVPKNEDGEVDSFKLIPVVQVAEVIRKTQFFKPNCSLVIIDFLFRHGYISPECFGYLDLLRSLRIGDCS*
• ORF Type: complete

Annotations of Ll_transcript_95700

• Blastp: Nudix hydrolase 20, chloroplastic from Arabidopsis with 76.97% of identity
• Blastx: Nudix hydrolase 20, chloroplastic from Arabidopsis with 77.27% of identity
• Eggnog: Nudix hydrolase(COG0494)
• Kegg: Link to kegg annotations (AT5G19460)
• CantataDB: Link to cantataDB annotations (CNT0000325)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019458672.1)
• Pfam: NUDIX domain (PF00293.27)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;