Transcript | Ll_transcript_95751 |
---|---|
CDS coordinates | 179-1132 (+) |
Peptide sequence | MDSSSFNHLPPLKRLRFIHQQQQQQQHRASSNSTLPAKKRKESRDSTFFHNPPTPFPTTLYSLPAKKRVCAFHPCDTVSLPFDLNIEYTPSPKKPINKIQSFTNPSPQKEKLVLDGDNEIDEDDGILCCVCQSTDGDPEDPIVFCDGCDLMVHASCYGNPLSKGIPEGDWFCERCRFDEKTGSSFSCCLCPIKEGAMKQTTDNRWAHIVCAVFVPEVFFSDPEGREGIDCSKVPTKRWSEKCYVCDTCDGCALVCSELKCGLGFHVTCGVREDLCIEYKEGKKGGTIVAGFCKSHSQIWEKQQLSGKYKIVAIEDKK* |
ORF Type | complete |
Blastp | Protein AF-10 from Homo with 37.29% of identity |
---|---|
Blastx | Protein AF-10 from Mus with 37.29% of identity |
Eggnog | phd finger(COG5141) |
Kegg | Link to kegg annotations (8028) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019413429.1) |
Pfam | PHD-finger (PF00628.28) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer