Protein coding transcript 137190

• Transcript: Ll_transcript_152112
• CDS coordinates: 1-426 (+)
• Peptide sequence: AIRVHDVAEDSLYTEDGTLDINKKPANKKKTGNWKACSFILGNETCERLAYYGMSTNLVNYLQERFNQGNATAANNVTTWSGTCYLTPLLGAFLADSYLGRYWTIATFSSIYVIVSSFQSVFFLKHGVLNSIRRWKVLLYF*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_152112

• Blastp: Protein NRT1/ PTR FAMILY 8.1 from Arabidopsis with 78.5% of identity
• Blastx: Protein NRT1/ PTR FAMILY 8.1 from Arabidopsis with 78.5% of identity
• Eggnog: transporter(COG3104)
• Kegg: Link to kegg annotations (AT3G54140)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462439.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;