Protein coding transcript 137215

• Transcript: Ll_transcript_151940
• CDS coordinates: 121-627 (+)
• Peptide sequence: MDKATLLAEVISQVKELKKNAMEASKGLIIPKDSDEVKVEPYDDEEGEGDGSVSYKASICCDYTPEILSDLRQTLDALKLKLMRTEISTLGNRMKNVFIFKCCKGDITNIEACQALQISVQQALSSVVNKASSSLEYLPRTSYPNKRRRLCSIETSTNSCNHESCSCS*
• ORF Type: complete

Annotations of Ll_transcript_151940

• Blastp: Transcription factor bHLH30 from Arabidopsis with 45.92% of identity
• Blastx: Transcription factor bHLH51 from Arabidopsis with 36.84% of identity
• Eggnog: Transcription factor(ENOG410YEFC)
• Kegg: Link to kegg annotations (AT1G68810)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019416260.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;