Protein coding transcript 137225

• Transcript: Ll_transcript_152047
• CDS coordinates: 176-544 (+)
• Peptide sequence: MAKKLSKVAFDAKLGKLLKEYSRVLVISSDNIGCNELQGIRRNLHADSVVVMGKNSMMKRSLMLDAQRTGNKAFLNLAPLLHGNVALIFTKSDLREVSEQVAKYKVTFFVLCKYEDAVFFYT*
• ORF Type: complete

Annotations of Ll_transcript_152047

• Blastp: 60S acidic ribosomal protein P0 from Soja with 65% of identity
• Blastx: 60S acidic ribosomal protein P0 from Soja with 65% of identity
• Eggnog: 50s ribosomal protein L10(COG0244)
• Kegg: Link to kegg annotations (547816)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019453731.1)
• Pfam: Ribosomal protein L10 (PF00466.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;