Protein coding transcript 1373

• Transcript: Ll_transcript_408075
• CDS coordinates: 306-1052 (+)
• Peptide sequence: MASTSRGGSGGAAGRIKNLASSFSSDYQPLITDIRKTMSFMKDIAVELEKDGLSDKVKELEDAVIELAGLSGLSVHFSSAVQAFANRYQPGEELTDFHKVFEDEVSQFKDNPTTDPKKHHFVRQFKEAVWKVHHEGQPMPGEEQEDIVMTSTQSSILNMTCPLTGKPVTELEDPVRSMECKHIYEKAVIMTYLRSKQQSRCPVSGCPKILVADKVVNDPLLLIEIDELRKMTKETNIVEDFTMIDEDD*
• ORF Type: complete

Annotations of Ll_transcript_408075

• Blastp: E3 SUMO-protein ligase MMS21 from Arabidopsis with 52.59% of identity
• Blastx: E3 SUMO-protein ligase MMS21 from Arabidopsis with 52.12% of identity
• Eggnog: non-SMC element 2, MMS21 homolog (S. cerevisiae)(COG5627)
• Kegg: Link to kegg annotations (AT3G15150)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019443919.1)
• Pfam: Zinc-finger of the MIZ type in Nse subunit (PF11789.7)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;