Protein coding transcript 137330

• Transcript: Ll_transcript_157353
• CDS coordinates: 182-493 (+)
• Peptide sequence: MISVYNIHHSSKVWDRAEEFLPERFDLDGPMPNETNTDFRFIPFSGGPRKCVGDQFALLEAIVALSIFLQNMTFELVPNQNISMTTGATIHTTSGLYMKLGRR*
• ORF Type: complete

Annotations of Ll_transcript_157353

• Blastp: Carotene epsilon-monooxygenase, chloroplastic from Arabidopsis with 79.61% of identity
• Blastx: Carotene epsilon-monooxygenase, chloroplastic from Arabidopsis with 80.31% of identity
• Eggnog: Cytochrome p450(COG2124)
• Kegg: Link to kegg annotations (AT3G53130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019461800.1)
• Pfam: Cytochrome P450 (PF00067.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;