Protein coding transcript 1374

• Transcript: Ll_transcript_408009
• CDS coordinates: 94-711 (+)
• Peptide sequence: MAARFLVLASILLCSFAGTCYGNVLFSSLKRTLDVTASPKQGQVLIAGSDKITVTWALNNTLPPGTDSSYKTIKVNLCYAPISQKDRAWRKTEDNLKRDKTCQFNIVTKPYLASNKTLQSFEMVIQRDVPTATYFVRAYAYDSNEVQVGYGQTTDAKKGTNLFEVQAISGRHVSLDICSICFSAFSVISLFVFFYVEKRKQKTQK*
• ORF Type: complete

Annotations of Ll_transcript_408009

• Blastp: High-affinity nitrate transporter 3.1 from Arabidopsis with 52.36% of identity
• Blastx: High-affinity nitrate transporter 3.1 from Arabidopsis with 52.36% of identity
• Eggnog: Nitrate transporter(ENOG4111P96)
• Kegg: Link to kegg annotations (AT5G50200)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019464577.1)
• Pfam: High-affinity nitrate transporter accessory (PF16974.4)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;