| Transcript | Ll_transcript_157302 |
|---|---|
| CDS coordinates | 297-635 (+) |
| Peptide sequence | MPYKLYLTCLLHMTGEFSKGYFYFWAVIAIAWGTIGSAVIIILPITESWGTIQNVFLGMFTNDRLMEKMDELNFKLKTIMQAIPEAERIYLLEKEKAKKLEASEQQAYSLPA* |
| ORF Type | complete |
| Blastp | Urea-proton symporter DUR3 from Arabidopsis with 66.27% of identity |
|---|---|
| Blastx | Urea-proton symporter DUR3 from Arabidopsis with 64.86% of identity |
| Eggnog | symporter(COG0591) |
| Kegg | Link to kegg annotations (AT5G45380) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019445200.1) |
| Pfam | - |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer