| Transcript | Ll_transcript_157433 |
|---|---|
| CDS coordinates | 178-996 (+) |
| Peptide sequence | MHEGVQNVVIPIQNRNSRKKGAEKAPSLVNPNHDNKTNYTYCWLTQEDVIRYLLNSIGLFSPASSSPINTLNVIDTQNLLAIYYEDPASSALDLLNVSLINGSSVAIVNPQGKFVGEISPVMLNSCDEGLVPPIATLSAGDLMAFIDAGGPPEDLVQLVKERLEKQNLGAALELLVGDESGISSWSSSSSSSSDEEFCSGKNWKLGGYSARVVRRSEAIVCYPWSSLLAVMIQALAHRVSYVWVVEEDGTLTGIVTFEGMLKVFREHLKTMS* |
| ORF Type | complete |
| Blastp | CBS domain-containing protein CBSX5 from Arabidopsis with 42.7% of identity |
|---|---|
| Blastx | CBS domain-containing protein CBSX5 from Arabidopsis with 43.31% of identity |
| Eggnog | CBS domain-containing protein(ENOG4111QFC) |
| Kegg | Link to kegg annotations (AT4G27460) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019425286.1) |
| Pfam | CBS domain (PF00571.27) |
| Rfam | - |
| GO | - |
Grab and slide to change sequence position
Alignmet by MSA Viewer