Protein coding transcript 137444

• Transcript: Ll_transcript_157366
• CDS coordinates: 1149-1949 (+)
• Peptide sequence: MFLQYKDLKRFFLSPFYHIGEPHLVYNMLSLLWKGFQLETAIGSVEFASMVASLLALSQGITLMLSKSLLLFFDYERAYYNEYAVGFSGVLFAMKVVLNARSEDYSYVHGVIVPSRYAAWAELVLIQMLVPGVSFLGHLGGVLAGLLYLRLKGTNSGSNPLTILIRGLTRAANWPLKFLRHLFRFQRGRISGRGTVGGNRAGNTAQSGVWRCQACTYDNPDLLTLCEMCGTGRTGNGLSSLQWNHDSDDIPLDELRRRRINRFGRW*
• ORF Type: complete

Annotations of Ll_transcript_157366

• Blastp: Rhomboid-like protein 14, mitochondrial from Arabidopsis with 63.91% of identity
• Blastx: Rhomboid-like protein 14, mitochondrial from Arabidopsis with 63.57% of identity
• Eggnog: Rhomboid domain containing(ENOG41100KJ)
• Kegg: Link to kegg annotations (AT3G17611)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019455576.1)
• Pfam: Rhomboid family (PF01694.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;