Protein coding transcript 137563

• Transcript: Ll_transcript_199006
• CDS coordinates: 44-559 (+)
• Peptide sequence: MTTSIPLTLFFFLFILISIPSSHCRTLEINNESLIVNTCNKTPDANLCIRSIKSRPGSATANLTGLSEISIDVLHFQVNNILNKIHDLQRAGTEPKQGLDSCEKNYTKMKEVDIPKAIQALKRGDGEGAENVAKGAAKEATNCETETRGSLSSQNKSVHDVATVAQAVARQL
• ORF Type: 3prime_partial

Annotations of Ll_transcript_199006

• Blastp: Cell wall / vacuolar inhibitor of fructosidase 1 from Arabidopsis with 34.06% of identity
• Blastx: Cell wall / vacuolar inhibitor of fructosidase 1 from Arabidopsis with 34.06% of identity
• Eggnog: cell wall vacuolar inhibitor of fructosidase(ENOG41113RP)
• Kegg: Link to kegg annotations (AT1G47960)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019431177.1)
• Pfam: Plant invertase/pectin methylesterase inhibitor (PF04043.14)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;