Transcript | Ll_transcript_198752 |
---|---|
CDS coordinates | 2-523 (+) |
Peptide sequence | PTCLLAKTLKGKGFPDIEDKEKWHGTVLGAKTDAVIAHVQKQIKNPGAALLKPQKPLKDDAPAVNLAVQLSSPPAYKLGETVATREAYGTALVKIGKNNPRVIALDGDTKNSTFSEKLKLENPAQYIECFIAEQNLVGVGIGAACRNRVISFVSTFATFFTRAFDQIRMGAISQ |
ORF Type | internal |
Blastp | Transketolase-like protein 2 from Mus with 54.55% of identity |
---|---|
Blastx | Transketolase-like protein 2 from Mus with 54.55% of identity |
Eggnog | Transketolase(COG0021) |
Kegg | Link to kegg annotations (74419) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_003609568.1) |
Pfam | Transketolase, pyrimidine binding domain (PF02779.23) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer