Protein coding transcript 137828

• Transcript: Ll_transcript_81910
• CDS coordinates: 130-783 (+)
• Peptide sequence: MHASTTFTSQYVYELLGDFHYRRLLLQNLNLSSNSATISSHNSTNLYLGGRSFDSNVVMVLSVLLCALICSLGLNSIIRCVLRCSNLAIHIDSSSTSNPPSGLSTTGIKKKALKTFPIVTYSAGLNLPNLDTECVICLSDFTNNDKVRLLPKCNHGFHVPCIDEWLSSHSSCPKCRQCLIETCHKIVASQATVVPETIIRIEPLELEGFVRNYREPN*
• ORF Type: complete

Annotations of Ll_transcript_81910

• Blastp: RING-H2 finger protein ATL78 from Arabidopsis with 52.34% of identity
• Blastx: RING-H2 finger protein ATL78 from Arabidopsis with 59.09% of identity
• Eggnog: zinc ion binding(ENOG41121N2)
• Kegg: Link to kegg annotations (AT1G49230)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019462729.1)
• Pfam: RING-H2 zinc finger domain (PF12678.6)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;