Protein coding transcript 137841

• Transcript: Ll_transcript_81773
• CDS coordinates: 206-742 (+)
• Peptide sequence: MEETEAEVAPALIAVHPHRSSVAVAVGYDLRVFDLLAGVGVTLVNDSSSSSSSSSSFHKDSIRAIRFSANGNLFVSAGDDKTLKIWSSISWRCIFTLSSEKRISAVAISNDESCVCFADKFGVVWVVDITGFDANQPLLDKKPTPLLSHYCSIITSLEFSPDDRFILSADRDFKIRVS*
• ORF Type: complete

Annotations of Ll_transcript_81773

• Blastp: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4 from Bos with 33.61% of identity
• Blastx: tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 from Danio with 36.15% of identity
• Eggnog: Required for the formation of N(7)-methylguanine at position 46 (m7G46) in tRNA. In the complex, it is required to stabilize and induce conformational change of the catalytic subunit(ENOG4111WRP)
• Kegg: Link to kegg annotations (508051)
• CantataDB: Link to cantataDB annotations (CNT0000374)
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454426.1)
• Pfam: WD domain, G-beta repeat (PF00400.31)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;