Protein coding transcript 137898

• Transcript: Ll_transcript_82001
• CDS coordinates: 255-1142 (+)
• Peptide sequence: MPSAPSKLYADDVSLLVVTLDTNPFFWSTFSVSFSDFLSQVLAFLNSILLLSQLNQLVVIATGCNSCGYVYDSASSKNHAPPTASMPALYSNLLHNLEQFVARDQKLSKPDHDTQGIVPASLLSGALSMALCYIQRAFRSGSMHPQPRILCLQGSADGPEQYVAIMNAIFSAQRSTVPIDSCYIGSNNSAFLQQASYITGGIYYKPPQLDGLFQYLSTVFATDLHSRAFLRLPKSLGVDFRASCFCHKQTIDMGYVCSVCLSIFCERHDKCSTCGSVFGQAKQDVTSANSKKRKA*
• ORF Type: complete

Annotations of Ll_transcript_82001

• Blastp: RNA polymerase II transcription factor B subunit 4 from Arabidopsis with 69.57% of identity
• Blastx: RNA polymerase II transcription factor B subunit 4 from Arabidopsis with 69.57% of identity
• Eggnog: Transcription factor(COG5242)
• Kegg: Link to kegg annotations (AT1G18340)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019438573.1)
• Pfam: Transcription factor Tfb4 (PF03850.13)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;