Protein coding transcript 137917

• Transcript: Ll_transcript_81761
• CDS coordinates: 479-817 (+)
• Peptide sequence: MTEALEQTGRIARLIGQGVPEDFLISAAVSEFKGPDIFGVVRLAQVNMELARVEANFSGLSPGKHGWSINEFGDLTRGAASTGKLFSPTNEKDAKVCFSTYLTNCYFSSNFL*
• ORF Type: complete

Annotations of Ll_transcript_81761

• Blastp: Copper chaperone for superoxide dismutase, chloroplastic/cytosolic from Arabidopsis with 80.68% of identity
• Blastx: Copper chaperone for superoxide dismutase, chloroplastic/cytosolic from Arabidopsis with 76.72% of identity
• Eggnog: heavy metal transport detoxification protein(COG2608)
• Kegg: Link to kegg annotations (AT1G12520)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019446629.1)
• Pfam: Copper/zinc superoxide dismutase (SODC) (PF00080.19)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;