Transcript | Ll_transcript_81763 |
---|---|
CDS coordinates | 3-866 (+) |
Peptide sequence | PSPLRTDPNPTSQVSYLFLIFIRLRVQFSKGSRAMNYTSETPLKSLVYDAAGFPELLTEYMVDMKCEGCVNAVKDKLQTIKGVKNVEVDLSNQVVRVLGSTPVKTMTEALEQTGRIARLIGQGVPEDFLISAAVSEFKGPDIFGVVRLAQVNMELARVEANFSGLSPGKHGWSINEFGDLTRGAASTGKLFSPTNEKDAKPVGDLGTLDANEKGEAFYTGVIEKLRVADLIGRAAVVYATEDKSEPGIVAAVIARSAGVGENYKRLCTCDGTTIWEASDRDFVTSKV* |
ORF Type | 5prime_partial |
Blastp | Copper chaperone for superoxide dismutase, chloroplastic/cytosolic from Arabidopsis with 65.51% of identity |
---|---|
Blastx | Copper chaperone for superoxide dismutase, chloroplastic/cytosolic from Arabidopsis with 65.51% of identity |
Eggnog | heavy metal transport detoxification protein(COG2608) |
Kegg | Link to kegg annotations (AT1G12520) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446629.1) |
Pfam | Heavy-metal-associated domain (PF00403.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer