Transcript | Ll_transcript_81765 |
---|---|
CDS coordinates | 1070-1477 (+) |
Peptide sequence | MELARVEANFSGLSPGKHGWSINEFGDLTRGAASTGKLFSPTNEKDAKPVGDLGTLDANEKGEAFYTGVIEKLRVADLIGRAAVVYATEDKSEPGIVAAVIARSAGVGENYKRLCTCDGTTIWEASDRDFVTSKV* |
ORF Type | complete |
Blastp | Copper chaperone for superoxide dismutase, chloroplastic/cytosolic from Arabidopsis with 70.07% of identity |
---|---|
Blastx | Copper chaperone for superoxide dismutase, chloroplastic/cytosolic from Arabidopsis with 72.39% of identity |
Eggnog | heavy metal transport detoxification protein(COG2608) |
Kegg | Link to kegg annotations (AT1G12520) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019446629.1) |
Pfam | Copper/zinc superoxide dismutase (SODC) (PF00080.19) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer