Transcript | Ll_transcript_81976 |
---|---|
CDS coordinates | 135-1172 (+) |
Peptide sequence | MADTVSSPSFVETTDSKNAFDLGAFVGDLNFEDHLTNDDISLEGLEQELEECKNNDVVANILSKGTKLRDYTKGVENDLRKLELDSIQDYIKESDNLVSLHDQIRDCDSILSQMETLLSGFQGEIGSISSDIKILQEKSMDMGLRLKNRKVAESKLAKFVEDIIVPPRMVDILVDGEVNEEYMRTLEILSKKIKFVQVDPMVKASKALKDVQPELEKLRQKAVSKVFDFIVQKLYALRKPKTNIQILQQSVLLKYKYVVIFLKEHGKEVYNEVRAAYIDTMNKVLSAHFRAYIQALEKLQMDIATSDDLIGVETRSSGLFIRAREPLKNRSAVFALGDRINILKV* |
ORF Type | complete |
Blastp | Vacuolar protein sorting-associated protein 52 A from Arabidopsis with 83.13% of identity |
---|---|
Blastx | Vacuolar protein sorting-associated protein 52 A from Arabidopsis with 83.13% of identity |
Eggnog | vacuolar protein sorting 52 homolog (S. cerevisiae)(ENOG410XNZ1) |
Kegg | Link to kegg annotations (AT1G71270) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019420934.1) |
Pfam | Exocyst complex component Sec3 (PF09763.8) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer