Transcript | Ll_transcript_82090 |
---|---|
CDS coordinates | 534-1454 (+) |
Peptide sequence | MGSRIPSHQLSNGLYVSGRPEQPKERTPTMSSVAVPYTGGDIKKSGELGKMFDIPVDGSKSRKSGPITGGAPSRTPSFGGVGSNSGPMQSNAAVRAVYTSGPMTSGGTGANLLKKSNSGPLNKHGEPIKRTSGPQSSGVTRHNSGPLPPVLPTTGLITSGPISSGPLNSSGAPRKISGPLEATGSMKLSGSATVHNQAVTILSEPVEFSFRRNIPKVVLWLLILLFVMGFIAGGFIYGAVQNPILLIVVVVLFGLVIASFTWNIYFGRRAIMSFVANYPDSELRTAKNGQFVKVSGVCFNFSCLTY* |
ORF Type | complete |
Blastp | Uncharacterized membrane protein At1g16860 from Arabidopsis with 66.23% of identity |
---|---|
Blastx | Uncharacterized membrane protein At1g16860 from Arabidopsis with 65.32% of identity |
Eggnog | NA(ENOG410ZNXM) |
Kegg | Link to kegg annotations (AT1G16860) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019426966.1) |
Pfam | - |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer