Protein coding transcript 138037

• Transcript: Ll_transcript_82144
• CDS coordinates: 3-497 (+)
• Peptide sequence: SNQFFRQHCSCCSWTTTLKWIVLYRVSLIKLNKLCAGEKGYGYKGSSFHRIIKDFMIQGGDFTEGDGTGGTSIYGARFKDESFALKHIGFGVLSMANAGPNTNGSQFFICTVKTPWLDNRHVVFGHVIDGMDVVKTLEFQETSRLDIPRKPCRIVNCGELTNED*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_82144

• Blastp: Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic from Arabidopsis with 78.74% of identity
• Blastx: Peptidyl-prolyl cis-trans isomerase CYP20-3, chloroplastic from Arabidopsis with 78.74% of identity
• Eggnog: PPIases accelerate the folding of proteins (By similarity)(ENOG410Z0G4)
• Kegg: Link to kegg annotations (AT3G62030)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019440650.1)
• Pfam: Cyclophilin type peptidyl-prolyl cis-trans isomerase/CLD (PF00160.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;