Transcript | Ll_transcript_81829 |
---|---|
CDS coordinates | 200-1021 (+) |
Peptide sequence | MASSKVGLATNPDQPRNSSSSSSSISSSSHHSLPTLFLNLSDSDHHRHPMDDLLNSIYPTAAAAAAAPPSKTADEVWKDIVAGNSSGTHQSNNNTNSEGLDVVTLEDYLIKERVLSVPSAAAAASGTTAMVQFGNGVDGTVVGTSGGGGGKGKRRVMEETVDKATLQKQRRMIKNRESAARSRERKQAYTSELEYLVHQLEQENARLLNETADEKRQRFKQVCNISAHFFFKQANDIFRGWDVKQDSLVNLHKSWIFDMLLLYISPSIRHSVY* |
ORF Type | complete |
Blastp | G-box-binding factor 4 from Arabidopsis with 34.88% of identity |
---|---|
Blastx | G-box-binding factor 4 from Arabidopsis with 37.5% of identity |
Eggnog | Transcription factor(ENOG410ZKZR) |
Kegg | Link to kegg annotations (AT1G03970) |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019441046.1) |
Pfam | bZIP transcription factor (PF00170.20) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer