Protein coding transcript 138109

• Transcript: Ll_transcript_199237
• CDS coordinates: 3-302 (+)
• Peptide sequence: TTLAQWLYNNDELMKGFIKVWICVSEEFDVVKITQTIIQGVTDVLCNTKDLSLLQEHLKDKLSGKKFFIVLDDVWSHDRHIWNNFIAPFQYGAKGSKILV
• ORF Type: internal

Annotations of Ll_transcript_199237

• Blastp: Putative disease resistance protein RGA3 from Solanum with 38.61% of identity
• Blastx: Putative disease resistance protein RGA3 from Solanum with 38.61% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019454470.1)
• Pfam: NB-ARC domain (PF00931.21)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;