| Transcript | Ll_transcript_199513 |
|---|---|
| CDS coordinates | 160-465 (+) |
| Peptide sequence | MKGDKVEVPIEPELAARLGYLSASVLPFVLHLVFMAGTAFFVMHVQVATRFLSASPPIYWFASYMIRHHAKCFRWGYMIWAYSAIYIFLGSLLFSNFYPFT* |
| ORF Type | complete |
| Blastp | GPI mannosyltransferase 2 from Sophophora with 39.74% of identity |
|---|---|
| Blastx | - |
| Eggnog | - |
| Kegg | Link to kegg annotations (Dpse_GA19757) |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019445861.1) |
| Pfam | Mannosyltransferase (PIG-V) (PF04188.12) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer