Protein coding transcript 13827

• Transcript: Ll_transcript_324025
• CDS coordinates: 27-662 (+)
• Peptide sequence: MAMASSLNPLSSVSSFQLTKKSLTLPSLASPFKGTLKTLVAKQSQFYYLSSSHQRKPILIVNKARALPVFVDPTRVRFRLDNLGPQPGSRKKAKRKGRGIASGQGASCGFGMRGQKSRSGPGVRPGFEGGQMPLYRRIPKLRGIAGGMRAGLPKYVHVNLRDIEPRFQDGEEVSLETLKEKRIINPSGRDRKLPLKVQTSCCFHDTQIPFLS
• ORF Type: 3prime_partial

Annotations of Ll_transcript_324025

• Blastp: 50S ribosomal protein L15, chloroplastic from Pisum with 68.88% of identity
• Blastx: 50S ribosomal protein L15, chloroplastic from Pisum with 73.3% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019428276.1)
• Pfam: Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A (PF00828.18)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;