| Transcript | Ll_transcript_324030 |
|---|---|
| CDS coordinates | 1819-2187 (+) |
| Peptide sequence | MRAGLPKYVHVNLRDIEPRFQDGEEVSLETLKEKRIINPSGRDRKLPLKILGHGELTKKLTIKARAYSASAKEKLETLGCSLTVLPGRKKWVKPSVAKNLARADEYFAKKRAAAAASEQASA* |
| ORF Type | complete |
| Blastp | 50S ribosomal protein L15, chloroplastic from Pisum with 80.17% of identity |
|---|---|
| Blastx | 50S ribosomal protein L15, chloroplastic from Pisum with 83.19% of identity |
| Eggnog | - |
| Kegg | - |
| CantataDB | - |
| Mirbase | - |
| Ncbi protein | Link to NCBI protein (XP_019428276.1) |
| Pfam | Ribosomal proteins 50S-L15, 50S-L18e, 60S-L27A (PF00828.18) |
| Rfam | - |
| GO | Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer