Protein coding transcript 1383

• Transcript: Ll_transcript_408015
• CDS coordinates: 2-790 (+)
• Peptide sequence: AIATFLAAVVVLQGAFCTPVLGPLDKLKQYFNKMISPHIIGGEDSPAPIPYQAALYIDRGTGAGFCGGVLISHRWVLTAAHCVRPVNFNGKATVEVVLGAKDRLQKEPSQQRMKSEQIIIHPGWKADPRSVADDLALIKLSQPATINSHVDFVRLPSDDQVQETFAQKPCLISGWGWDSDHAGSSVAKLQMLETQIVSNNMCRQSFGAYIKDNLVCTSGAGRRGACRGDSGGPMVIYEEDGKPTLLGIAAFVHSSSCEGGHPS
• ORF Type: internal

Annotations of Ll_transcript_408015

• Blastp: Chymotrypsin BII from Litopenaeus with 38.6% of identity
• Blastx: Chymotrypsin BII from Litopenaeus with 38.6% of identity
• Eggnog: -
• Kegg: -
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019448630.1)
• Pfam: Trypsin (PF00089.25)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;