Transcript | Ll_transcript_408015 |
---|---|
CDS coordinates | 2-790 (+) |
Peptide sequence | AIATFLAAVVVLQGAFCTPVLGPLDKLKQYFNKMISPHIIGGEDSPAPIPYQAALYIDRGTGAGFCGGVLISHRWVLTAAHCVRPVNFNGKATVEVVLGAKDRLQKEPSQQRMKSEQIIIHPGWKADPRSVADDLALIKLSQPATINSHVDFVRLPSDDQVQETFAQKPCLISGWGWDSDHAGSSVAKLQMLETQIVSNNMCRQSFGAYIKDNLVCTSGAGRRGACRGDSGGPMVIYEEDGKPTLLGIAAFVHSSSCEGGHPS |
ORF Type | internal |
Blastp | Chymotrypsin BII from Litopenaeus with 38.6% of identity |
---|---|
Blastx | Chymotrypsin BII from Litopenaeus with 38.6% of identity |
Eggnog | - |
Kegg | - |
CantataDB | - |
Mirbase | - |
Ncbi protein | Link to NCBI protein (XP_019448630.1) |
Pfam | Trypsin (PF00089.25) |
Rfam | - |
GO | Links to GO: General; Genes and gene products; Annotations; Ontology; Links to GO: General; Genes and gene products; Annotations; Ontology; |
Grab and slide to change sequence position
Alignmet by MSA Viewer