Protein coding transcript 138343

• Transcript: Ll_transcript_275212
• CDS coordinates: 1-645 (+)
• Peptide sequence: FQLKRHMATTTKPRPNITFFFLLLVLPFNFGKSQLQLNYYTNSCSKAEEIIKQQVFQLYNKHGNTAISWVRNLFHDCMVKSCDASLLLVNRGGVVSEQTAERSFGMRNFKYVNTIKEAVEQECPLTVSCADIVALSARDGIAMLGGPNIEMKTGRRDSKESYAMMVEEFIPNHNDSISLVLSSFQAIGVDIEATVALLGIFPSLLKAPLSHIFP*
• ORF Type: 5prime_partial

Annotations of Ll_transcript_275212

• Blastp: Peroxidase 21 from Arabidopsis with 71.1% of identity
• Blastx: Peroxidase 21 from Arabidopsis with 71.76% of identity
• Eggnog: peroxidase(ENOG410YHIH)
• Kegg: Link to kegg annotations (AT2G37130)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019432275.1)
• Pfam: Peroxidase (PF00141.22)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;
  Links to GO: General; Genes and gene products; Annotations; Ontology;