Protein coding transcript 138373

• Transcript: Ll_transcript_275331
• CDS coordinates: 256-663 (+)
• Peptide sequence: MVHNLHQRLHNLQIAVQKCMSEKRKLEEHLQIVESDWAKAKNELQKEKKHVQCLTVECDKSCETAHIAKITVEAIRQELQEERERVQLLTENVRIAQSRASFAEAKLRDLDRKIRSKDHKVAVWTDSLGKSAMHF*
• ORF Type: complete

Annotations of Ll_transcript_275331

• Blastp: Nuclear-pore anchor from Arabidopsis with 35.97% of identity
• Blastx: Nuclear-pore anchor from Arabidopsis with 32.5% of identity
• Eggnog: translocated promoter region, nuclear basket protein(ENOG410XSA1)
• Kegg: Link to kegg annotations (AT1G79280)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019449297.1)
• Pfam: -
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;