Protein coding transcript 138404

• Transcript: Ll_transcript_275021
• CDS coordinates: 190-645 (+)
• Peptide sequence: MAGVHIPRVKLGSQGLEVSKLGFGCMGLTGGYNAPLAEEDGISIIKYAFNNGITFFDTADVYGANNANEVLVGKASKQLPREKIQIATKFGIEKFDLFNNLITIKGTPEYVRSCCEGSLKRLGVEYIDLYYQHRVDATVPIEETVRNFLLL*
• ORF Type: complete

Annotations of Ll_transcript_275021

• Blastp: Probable aldo-keto reductase 1 from Soja with 75.17% of identity
• Blastx: Probable aldo-keto reductase 1 from Soja with 67.27% of identity
• Eggnog: Aldo keto reductase(COG0667)
• Kegg: Link to kegg annotations (100301897)
• CantataDB: -
• Mirbase: -
• Ncbi protein: Link to NCBI protein (XP_019439928.1)
• Pfam: Aldo/keto reductase family (PF00248.20)
• Rfam: -
• GO: Links to GO: General; Genes and gene products; Annotations; Ontology;